SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|55715|e_gw1.6.101.1 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|55715|e_gw1.6.101.1
Domain Number 1 Region: 13-268
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.11e-87
Family Crotonase-like 0.000000258
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|55715|e_gw1.6.101.1
Sequence length 269
Sequence
MDLASACGCTNTGQQNILTEKQGNVAIVTLNRPKALNALSGALIQELLQALKAFDKDDDV
GAIIITGNERAFCAGADIAEQKALSFTQAYNTDYLRDIVDSILAIHKPIIGVVNGYALGG
GCELAMMCDIVYAGEKAVFGQPEIKLGTIPGAGGTQRLIRAIGKAKAMHMILTGENMSAT
EAEKAGLVAKVLPVNEVLPAAIKAATTIAGYSRPVVAIAKEAVNEAEELGLRNGLHFERR
LYHSTFALSDHQEGFGAFLEKRQPQWKHV
Download sequence
Identical sequences XP_007768216.1.51617 jgi|Conpu1|55715|e_gw1.6.101.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]