SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|60506|e_gw1.10.368.1 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|60506|e_gw1.10.368.1
Domain Number 1 Region: 340-579
Classification Level Classification E-value
Superfamily vWA-like 1.33e-65
Family Trunk domain of Sec23/24 0.00000222
Further Details:      
 
Domain Number 2 Region: 113-253,583-677
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.7e-59
Family beta-sandwich domain of Sec23/24 0.00018
Further Details:      
 
Domain Number 3 Region: 786-937
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 6.54e-34
Family C-terminal, gelsolin-like domain of Sec23/24 0.0000486
Further Details:      
 
Domain Number 4 Region: 678-785
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 1.91e-27
Family Helical domain of Sec23/24 0.0004
Further Details:      
 
Domain Number 5 Region: 255-339
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 2.75e-26
Family Zn-finger domain of Sec23/24 0.00013
Further Details:      
 
Domain Number 6 Region: 6-38
Classification Level Classification E-value
Superfamily WW domain 0.00000315
Family WW domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|60506|e_gw1.10.368.1
Sequence length 942
Sequence
MATQGQQLPPGWTAEWYPNQRYLFIETATGHTQWEDPNQAPTAPVDGSTLSPPGPAQAHA
KRRQYAAGQTQAYYSGGDGYGDQPGYGAAPPQQVPPPGAGPQLFTPGLSGDNQFAAQQQQ
QQGQAQYYAPPQEPQYINAQGFGQEPAYHPPAQQQQMDQLAGQFGGMGMGGQKPLQLYTT
NLLTSPPDPRELARPPPDILLPPNSCISNSPYANADASYQRSTLRAIPTTSSLLGKSKIP
LALVAVPYRSVKEGDQPVPLVTDTVIARCRRCRMYINPYVQFIDGGNRWRCCVCNMSNEV
PQLFDWDQARNQPGDRWSRPELNHGVVEFVAPTEYMVRPPQPTVYVILIDVSHSAVQSGM
VATATRTLLENLERLPNDDQRTKIAIIAYDVSLYFFSMPPGQTEPTMLVVSDVDDVFLPK
PTDLLVNVLEAKVALENLMGRVNDMFQDNHTVGCALGPALQAGFKLMAPIGGKIIALCSS
LPSIGAGALKNREDPKILGTSKESGLLQAGTPFYKTFAIECSRAQVAVDMFLFSSTYQDV
ASLACLPHYTSGQTYFYPAFNAARSEDAIKFAHEFGEVLATPIMLEAITRVRASKGLRLA
TFHGNFFVRSTDLLAMPAVSQDQSYAIEIQIEDTLTQPFVVLQTAILHTTCFGERRIRVV
TSAFPTTSSLSEVFASADQVAIATLLANKAVERSLTHKLEDAREALMSKVVEILVAYKSS
MTAAGAGASAQLAVSENLKMLPVLVLGLLKNVGVRQSAQIPPDLRAYAQALLTQLPAQTL
IPYIHPNFYSLHNMAPEAGTVGENGIIMPTPLPLTSERLERHGLFLIEDGQTVFLWVGRD
AVPQLIMDVFDLPGYDALRGGKTTLPLLENSFSQRVNAVIQKTREMRRGVYYPHLYVVKE
DGEPPLRLWALSCLIQDRADVLPSYQQFISQLKDKVNGANNY
Download sequence
Identical sequences XP_007771104.1.51617 jgi|Conpu1|60506|e_gw1.10.368.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]