SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|60750|e_gw1.10.332.1 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|60750|e_gw1.10.332.1
Domain Number 1 Region: 1-184
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 8.96e-45
Family YfcE-like 0.000000776
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|60750|e_gw1.10.332.1
Sequence length 213
Sequence
MVLVLVIGDLYIPNRVHDLPAKFKKLLVPGKIQQILCTGNVCDRETYDYLRTVASDVHVT
RGDYDESSAFPFSVTVTHTPIKIGVIHGHQCVPTGDLDALAGIARQLDVDVLVSGHTHTF
QAIEYDGKFFVNPGSATGAWTGLPTAAPNPTPSFALLDIQGPVVVTYVYQLVDNEVRVEK
IEYRKELVPANESRCSTVMPQNIPSSPAHQSVW
Download sequence
Identical sequences XP_007771120.1.51617 jgi|Conpu1|60750|e_gw1.10.332.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]