SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|67635|e_gw1.21.191.1 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|67635|e_gw1.21.191.1
Domain Number 1 Region: 5-231
Classification Level Classification E-value
Superfamily Osmotin, thaumatin-like protein 2.22e-58
Family Osmotin, thaumatin-like protein 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|67635|e_gw1.21.191.1
Sequence length 232
Sequence
MARSMTVYNGCPFTIWPAMYTGSGTAPSYTTGWSADEYTAVTFDVPDNWTAGRIWARRDC
DFSTNPGPNSCLDGGCNGGLVCTDPGVPPASLAEFTLDANGVDYYDVSLVDGYNLPVEIN
NTGGCGVASCPVDLGPDCPAALQGPYDSTGFPVGCKSACDANLDGDPSNSPNCCTGQYDT
AATCPSSGVAYYSYFKDNCPDSYCYAYDESSGTALWTCTSLPDYTVTFCPPS
Download sequence
Identical sequences R7SEK7
jgi|Conpu1|67635|e_gw1.21.191.1 XP_007775515.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]