SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|68664|fgenesh1_pg.1_#_130 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|68664|fgenesh1_pg.1_#_130
Domain Number 1 Region: 101-230,270-286
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 6.05e-16
Family Class I glutamine amidotransferases (GAT) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|68664|fgenesh1_pg.1_#_130
Sequence length 348
Sequence
MSTKQHFCKVPKSTTYLRDFPQLSKLPFPHIPQIAFINCDDTKPEFVNKFGTVSDVFYNL
LKNYLQSLLHPRPACEWFSNDGWFDWHCFDAQKGQLPILDGTARYDCIIVGGSSSCVNDS
DEWICNLSNLIYEAALMHSDIKLIGVCFGHQLICKVLYSHVRVVKGPWEVGPYTIKLNQA
GSLLFGGVNTLNLNMLHADSVCSESYETRLRHSVIGEFRGANASPACFLHSDRSPVSQPI
TWGNTVCTEATTCQGTVVFDSDLGAIGNADGVRVRVFTMQGHPETTESMAELLLELFTRP
GEDKEAIPECVAEEARKRMACSSGVLDLDRVAGTIWAVASGARFPTFD
Download sequence
Identical sequences XP_007762642.1.51617 jgi|Conpu1|68664|fgenesh1_pg.1_#_130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]