SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|70424|fgenesh1_pg.2_#_757 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|70424|fgenesh1_pg.2_#_757
Domain Number 1 Region: 35-90
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000816
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|70424|fgenesh1_pg.2_#_757
Sequence length 333
Sequence
MVTKCPSKVEIAQSKPVRMRKCPYPSCTFTARDITGLKHHWNRHTGQRPYHCLVGSCDYR
AVHPSNAVRHRSSIHNMDIAGFKLYCKMCNVDPSPVWDKALPGPLPELVVNKLFFGSETC
NVNANDIHKPVDILTRKPNCDFAQIQAQPVMAPTNANMGSLDIPSNPYADGTNPNHVLPA
TLTADIAVSLTNTQTSQGYHPSAWSSLANWNGAATSSVSDYEISPVDEDASSVSSVTHNS
ELLGSLHQHSDAPMTPTFSSPASQLDPLEHLLEADQANQYSMDFTRPRQLDYDMNSIEPM
PTANVTPSEFEYVPQMTEENFVREYLRQIEMHF
Download sequence
Identical sequences XP_007764210.1.51617 jgi|Conpu1|70424|fgenesh1_pg.2_#_757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]