SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|70647|fgenesh1_pg.3_#_92 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|70647|fgenesh1_pg.3_#_92
Domain Number - Region: 198-250
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000293
Family Classic zinc finger, C2H2 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|70647|fgenesh1_pg.3_#_92
Sequence length 291
Sequence
MASSEMSLTLSISQLLQFHVFAGPASVQPSLQLKPSPQPFFATLSPDLSSIAIKIQTQCV
SGHRVLSIFAIPRPDQPNFVNSSSLAPSSASNPPVQYMTPRNIAPLSDFPLAEASPSTWI
FNLSATHIMTRLAADFDFFAQEALMTSYDSFFSTLPPLEVPSSDYLSLLGHKSQAYTPIS
SASAEVDTTVPRKRPRRFACPDPSCKRKFASKDTLELHMTMRQHTRKVRYQCEMGCSETF
SRQHDRLRHEVARHARVPDWMCHRCKHVFSSQSNQNKHKCPDFIAADSLCS
Download sequence
Identical sequences jgi|Conpu1|70647|fgenesh1_pg.3_#_92 XP_007765376.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]