SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|70923|fgenesh1_pg.3_#_368 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|70923|fgenesh1_pg.3_#_368
Domain Number - Region: 4-32
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0586
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Domain Number - Region: 30-61
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0736
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|70923|fgenesh1_pg.3_#_368
Sequence length 190
Sequence
MPPPSRRSKCHRCTKCNQCFTSVRDARIHINGIQCLICSAEGPDPSGMRRHCQHAHNILK
PRSKVHYERFNESIEWKEHHEKLQAGDLAANASVPAPAHENTPQFPSTSTNAWFTDAAPH
WIPNDEAVTTGSSVSPDHGSPISMSGQTNPAGWSWLLQASSTQSSSDSIDAYPSDDWSLE
LDDSWWNMWR
Download sequence
Identical sequences jgi|Conpu1|70923|fgenesh1_pg.3_#_368 XP_007765413.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]