SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|73697|fgenesh1_pg.7_#_378 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|73697|fgenesh1_pg.7_#_378
Domain Number 1 Region: 3-60
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000357
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|73697|fgenesh1_pg.7_#_378
Sequence length 559
Sequence
MARCPFCHYIAKQKRNLDAHKATHHLTVDQYSTGEKPHVCPTLQCGRAFGDPSALIRHRK
AIHKYEAKPRRRNLSGHGFPPYMRHATTSQLEEDLSSLRPDLGSQTCSPSTSTTSLSNTS
DFQFLQQPLLGDQPGLISTNQLFPETLYTFSATSVSPHDHSLSASDFSTFAAGGASNLLY
DSRSCDGDPSHQPLPQGPFGSFSTHSSTAYPPLQSNGYQGDAVADYFDNMQARGAFECST
EINNYSRNSFEDTYWGPSQGHQHCHFSEHTWPTILPEILTRLRKPKIKVCYRAVAALPLT
DKVNLQVYVDEVGVDDCDIKFFMAEAMHNHRDMLSLIRRELDAPQHDVSEKGENEPDDRS
RCCNTGTSKSLIITDGPRGGVRVKVEEWIRRRKLTRGPKTTGPRASTSFLSTFSRSSPWI
GPFCKEVSNEGVETIRFSVFVATNSFPRTIEFAYATSRGRHRSKIGVDQEPNLHPRFKGL
EMLYKRLRLMREVPVLSVAILEDIILAGTMKYMEFRVERFEHWRALQSPFTSVGIAVKPP
LFTRLPTMVANPPKQPRGD
Download sequence
Identical sequences XP_007769115.1.51617 jgi|Conpu1|73697|fgenesh1_pg.7_#_378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]