SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|74620|fgenesh1_pg.9_#_249 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|74620|fgenesh1_pg.9_#_249
Domain Number 1 Region: 33-178
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 4.53e-29
Family Eng V-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|74620|fgenesh1_pg.9_#_249
Sequence length 202
Sequence
MSLKHLAVSTFLFALAGASAIDKRADGGYIQNASGSASFTQYSGCGSPACGIPASGFTAA
MSQLAFGSASGLGAGDACGRCFAVTGSADPYSPGFTGPFSTVVVKITDLCPAQGNEEWCG
QSQSSPTNQHGASVHFDLCEDSGAAGAFFPSGHGALTGSYQEVPCSQWSGSDGNPLWTGA
CLSGENASIWPSTGCGNKGTAP
Download sequence
Identical sequences jgi|Conpu1|74620|fgenesh1_pg.9_#_249 XP_007770528.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]