SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|76002|fgenesh1_pg.12_#_183 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|76002|fgenesh1_pg.12_#_183
Domain Number 1 Region: 3-191
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 2.29e-33
Family DJ-1/PfpI 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|76002|fgenesh1_pg.12_#_183
Sequence length 198
Sequence
MAKKVLILIADGTEEMEFTIAYDTLVRAGIECTSALVSASSSATHATCSRGVKIVPDTIF
NPSESGPEKYDALIVPGGAQGAKTISETAAVQELVRAYHEKPGRIVGSLAALTSADGGDT
IGEQELTSHPSIKDQLKEKFAYSDEPVVVSKSGKLITSRGPGTAFPFAFKLVELLAGAGK
RDETIGPMVFPAGTPLKF
Download sequence
Identical sequences XP_007772436.1.51617 jgi|Conpu1|76002|fgenesh1_pg.12_#_183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]