SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|76572|fgenesh1_pg.14_#_63 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|76572|fgenesh1_pg.14_#_63
Domain Number - Region: 374-433
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0445
Family beta-sandwich domain of Sec23/24 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|76572|fgenesh1_pg.14_#_63
Sequence length 1074
Sequence
MSFSQPPSYGASDSQDNASMQQQQQQQQQQQHGLDSITLGQLRAMVSSAPKPKQSYYDFR
YDDEDTVMNEIDEFYSYVEMPQVAENLKAWQHGSFPGDWTSPNTTDAQRKVHIEVLLESL
EHRDAEVRFTNARRLLYILQGTFAETTSPEHQLHWVYQNCKMVRAANGLSTIVESMKIAS
QKHDLLSSLSDADAARFHISPEEKADFLEEVITEISVLLGMLYHLIEIFKERDDFADELM
SMDPPLPVYFFKLVSILRDRGAKGYPIKKLLLVLWKSLLACCGGIRELSRVKLLARELAD
LPNLEDEALSIKCSPFDMEAFQQETSVKYPTFTAPAPPTSLPNIPAPIAKTKESLPTSKL
AQAYSPIPVRHHYHHDDHDTQTGIPGSQFHQQGQNSGYRPNPQPATPAPSPPPSPKPKKQ
QYQTDQNRPFLFPFSKKSQIRGGNRLIPFAIDEADKLYNKHMYVSLALWQMWRTREECMI
AESGLDYKPDPEQAFEESENAQPLRDIAHIDTKITEAEAAIGKADKPSEERKTRERKEDL
MRLKRVEQIYVRFLSAVLPLLPGCVSVLLKLVLATISSPQQNQQQGPQSNNSSMFQSGVA
SPPEQLPPPPQSLEEIDVIRHREITSKAVSAIVLLTLKWFKASHVMKFHHLGQLLLDYNC
LLLVLKMFGWQEVTASVVSKADSPDHNFFRYCQIHHARNPHATHEQPRPPFHVVVQTKNL
PNGQKHEEEVEMLSEFSWRNFFAMINYAKIMQKLSKSRSHRIWMLVQYKSSAVLKRVLRV
PHPMLQLHVLKLIKSQVPFCGRKWRQSNMKVITSIYLNCRPDLRDEWLTGTEVDDISDAQ
ATNQAAAAHRRSVSLSQNMEGLPPGLDIGNVIRPLGTPNVVEADVFPPSRSQAPDPSIFL
PYTTEDIAFEEEYEEYLSDLGFHDATMDTNPLFGGPNAMSAWSRLPESVTDITDNISDSE
SVVTIGDLGDGDGDGDDNRLDPSSTGSELQDENVNNWEHMSPKTMAALPKSPASARRSSS
GSRLRPVLPFKLDDGSAVDAEEEEEDLPMGPAPREQEGPFASGGGVDEVEYAWG
Download sequence
Identical sequences jgi|Conpu1|76572|fgenesh1_pg.14_#_63 XP_007773429.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]