SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|77776|fgenesh1_pg.18_#_199 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|77776|fgenesh1_pg.18_#_199
Domain Number 1 Region: 66-266
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.53e-20
Family Class I glutamine amidotransferases (GAT) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|77776|fgenesh1_pg.18_#_199
Sequence length 344
Sequence
MSDSNLPPHANICLIICDPTKEEFIDSYGNITNLFTNLYTKLLLRLTREPSSLLPMVLKS
FRIHPYNVVQDNFPDIKTIDQFDSILVSGSANGVNDPDQWIEKLGKLLHTVATDHPKVKL
MGVCFGHQIISKAVLGLPVGENPKGWEIGPYEVNLNETGKQLFENHEHLNVSMFHHDAVF
TRSQLAFFDELVETTPYSSNVPQNEYKIWASTPATANQGVISMNKQAAKSGRLNVDDIHI
FTTQGHPELNQGMTSYLVDLFEHELGADVAAEARKRIADFKGILDWFQLSIVMWALTTKH
SLSLPQLSEKINGYESAVKGVEKSGGFKAEAALMEEEKVFVLIT
Download sequence
Identical sequences jgi|Conpu1|77776|fgenesh1_pg.18_#_199 XP_007775043.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]