SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|77901|fgenesh1_pg.19_#_81 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|77901|fgenesh1_pg.19_#_81
Domain Number 1 Region: 27-122
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 2.79e-16
Family Barwin 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|77901|fgenesh1_pg.19_#_81
Sequence length 130
Sequence
MYSPIALLYLFLAPPAVLASGGLATSNETSLTKRVDHDDQRMTWFDVGLGACGQISTPDQ
HIYGTGKFCGREITISSGGKNTTAIVVDSCPGCPQYGLDLSVGLFGFFAPTSDGVIYGDW
HFDWVGFVPE
Download sequence
Identical sequences R7SFU8
XP_007775222.1.51617 jgi|Conpu1|77901|fgenesh1_pg.19_#_81

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]