SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|77906|fgenesh1_pg.19_#_86 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|77906|fgenesh1_pg.19_#_86
Domain Number 1 Region: 10-107
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 0.000000000283
Family Barwin 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|77906|fgenesh1_pg.19_#_86
Sequence length 122
Sequence
MFSKTLVLLGALGLVSAQSFTNQNMTQFSPSNKTLACGQTHSDTEYVVALQATIWSGGSL
CNKTINISNGKGLSTNATVVDEFFTGNAEDLELAPSLFRFLTGPGVDVPNVDSFLADWSW
VN
Download sequence
Identical sequences R7SHT1
XP_007775228.1.51617 jgi|Conpu1|77906|fgenesh1_pg.19_#_86

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]