SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|78524|fgenesh1_kg.1_#_2_#_isotig03129 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|78524|fgenesh1_kg.1_#_2_#_isotig03129
Domain Number - Region: 24-157
Classification Level Classification E-value
Superfamily Osmotin, thaumatin-like protein 0.000379
Family Osmotin, thaumatin-like protein 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|78524|fgenesh1_kg.1_#_2_#_isotig03129
Sequence length 265
Sequence
MTLSLFIRIVVLFFTVLVSAEQHTISFVNRCGYGTPALVLDGKNISTGQSYTSNGPFSGI
AYLQTGPCLANGENCALLEMTLINPTVAGGGSSTDISLIAPHKYNVETSFAYYGGCNGQG
TTCSSANCNTAFFNPNDNQVQVACQANNVNLVITFCSNASDFVTSSGSLASSPSSGSGSG
PEPTSASASGTPTSSNISSSSSASVAFPTGSSAIATPTSSSGSKSCSTKKRSKRGALEAN
VADDITSKRRGMKQHRRRRALSSDH
Download sequence
Identical sequences XP_007762726.1.51617 jgi|Conpu1|78524|fgenesh1_kg.1_#_2_#_isotig03129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]