SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|79786|fgenesh1_kg.2_#_312_#_isotig04303 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|79786|fgenesh1_kg.2_#_312_#_isotig04303
Domain Number 1 Region: 161-466,509-525
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.28e-70
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000618
Further Details:      
 
Domain Number 2 Region: 990-1040
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000967
Family Ubiquitin-related 0.0076
Further Details:      
 
Domain Number 3 Region: 843-918
Classification Level Classification E-value
Superfamily DUSP-like 0.0000824
Family DUSP, domain in ubiquitin-specific proteases 0.02
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|79786|fgenesh1_kg.2_#_312_#_isotig04303
Domain Number - Region: 1114-1134
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00706
Family Ran binding protein zinc finger-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|79786|fgenesh1_kg.2_#_312_#_isotig04303
Sequence length 1136
Sequence
MAPKRKRRASPVPKGLPAGQLLKRTRLSGDASSAWTWVGTEISEASQITLEHRLMTCYLS
KRNTKPFCPNRYIPPVKSPNGVHTHTIEKSTAMSTAEDDLDDVVVVSENETNNCTKKACR
NNPNCLNHLGQDKWEDEEKAKRTYIQALELGENPAVYSRDPHIPVGLKNLGATCYANAFL
QVWFRDLAFREGVYQCQLSEDKDKKIEESPIFQLQVTFAALQKSTQNVYNPTKLVESLKL
STSEQQDAQEFSKLFMSLLDHEFQKQTIPSLKSLVSSQFQGQLIYGTRCCHCKKSSERAT
DFLELEVNIQNNVRLEARVAALLQDEKLTGDNKYSCSNCLSLHDAIRYTELRRLPPVLHF
SLLRFVYDFSSMERKKSKHNVLFPTVLDMGQFLKATKDGEPTPQGHDIYELRGVLLHRGS
SAYHGHYEAQVFDTSSRTWFQFDDEDVVSIQSLGEKKYTGKDMVDILNGNEDRKLSAARG
RPSKRPRLEESERENLKPKNQHESGDQEDVYSSKDAYMLIYARKESDTTSLSVGSTGPSP
PEKAMAHIREGNECHMVTLASYKQKEDEAVARFVQQRSAMRDIFASWQTSSSDEESFVVS
RQSLETWVAKPFAKSKNPQIDKEPLSIETEVEEVSDILCAHEGLDPRKAGNMKRINAQSY
RRIADEFSDKISPAQSPESVCETCVHDLFLEKLYQVEHPRMVSQLDDCCDDDLEEDGYWI
SKSWVKDWRLQKPKMHSLHVDVPPDATPFRYHVLCEHGELSLHASTRRLISAKATKLLKT
LFPSWQPLPSATGPCPICEAAHSNNIEDKKEARKAAEEEKTQLRHMSENALAGNLLLLEN
VACAVIPTLFVRMWKQWLSRPGDSHRPDNVDNAMFLCKHDKLNFDPNSPGDMDNYVAVIQ
ESDWRILSSLYKCGPEIALTKQVVEEPEGVFETKFVHDIPVCQECRLRRKTDFEYTELTI
RLLHSKDSAKDTSTKNLSNSNTRQSRRIRQVRQRSGKTHVMVSKATTVKDIKVMIQDDLK
IPTICQKLFFHDLELEDSTTTMVALGVEINDCMDLREEKESGDLSDSSDDGGGRKRPKER
GFGGTLLGSSLPGSSQTTERSASASSEEHLGGSACSQCTFINSLHLAQCQVCGNQL
Download sequence
Identical sequences XP_007764277.1.51617 jgi|Conpu1|79786|fgenesh1_kg.2_#_312_#_isotig04303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]