SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|80106|fgenesh1_kg.2_#_632_#_isotig09768 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|80106|fgenesh1_kg.2_#_632_#_isotig09768
Domain Number 1 Region: 17-143
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 0.0000000181
Family Eng V-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|80106|fgenesh1_kg.2_#_632_#_isotig09768
Sequence length 145
Sequence
MFASTSTILALAAIAAPAFAQSTQSVSYDNTYDSGSGSMSTVACSDGSNGLASKWPTFAN
VPNFPNVAGVPAITGWNSAACGSCWELSYAAGDINATVYVTGVDVGRDGFVLSEATMNNL
TDGNAEAFGRISATATQVDSSNCGF
Download sequence
Identical sequences XP_007764323.1.51617 jgi|Conpu1|80106|fgenesh1_kg.2_#_632_#_isotig09768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]