SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|81175|fgenesh1_kg.4_#_317_#_isotig08936 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|81175|fgenesh1_kg.4_#_317_#_isotig08936
Domain Number 1 Region: 94-178
Classification Level Classification E-value
Superfamily PCD-like 0.000000000379
Family PCD-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|81175|fgenesh1_kg.4_#_317_#_isotig08936
Sequence length 219
Sequence
MADLETKKDIITRVEISPQLYYNLSFSPGDTTTSDALTYPLPRQDELPKLPALPESWRYA
PHLSSTDLDVYGRPLISRGWRVIPAGESSETGLTLAIASEYQFSRYKTAREFLNLLCDMS
SEEKHHARITLDHKTVSVQLQTHTAHIASTDNADNRVVYKVSGLTARDIRWAIRCEQVRT
NMVDMATVQISQEELIRTQRHSMKCLLWRYGGKTELITS
Download sequence
Identical sequences jgi|Conpu1|81175|fgenesh1_kg.4_#_317_#_isotig08936 XP_007766536.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]