SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|81223|fgenesh1_kg.4_#_365_#_isotig08817 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|81223|fgenesh1_kg.4_#_365_#_isotig08817
Domain Number 1 Region: 43-156,201-242
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.68e-17
Family Class I glutamine amidotransferases (GAT) 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|81223|fgenesh1_kg.4_#_365_#_isotig08817
Sequence length 286
Sequence
MTIRIAVFKCGTLDHRTILGSFLTKTAPDGLVNPFELDLFNVYEDEYPANIDDYNVVWLT
GSSSNVPDPEPWILKLGRLVHDIAENHTKIKLVGICFGHQLISHAVFGSKVDVNPKGLEI
GPYDVFLNAVGQAYFEPEVDKLWLEMWHAYMVFSPTLISKLRGIADAGNRTRNFLVYKWG
SSELTPNQGSVSRGISDFSRSPTTSAEEIVLDRDLIYAETRIFTSQGHPEYTKDLIAEFI
DESEQSGDITKEQADDARRRNELNKVLDEQKMGEVIWKVMLTPLKI
Download sequence
Identical sequences XP_007766544.1.51617 jgi|Conpu1|81223|fgenesh1_kg.4_#_365_#_isotig08817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]