SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|81856|fgenesh1_kg.5_#_403_#_isotig09634 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|81856|fgenesh1_kg.5_#_403_#_isotig09634
Domain Number 1 Region: 1-226
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 5.87e-65
Family DJ-1/PfpI 0.0000303
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|81856|fgenesh1_kg.5_#_403_#_isotig09634
Sequence length 228
Sequence
MTKKVLFVLTSCDKTLTGAQTGWYLPEAVHPFNVLAAAHGVEIDFAAPKGPNPPVDEGSV
KNFPDDAGFLSAASPKSKLESTKKLSAVEASDYDAVFYVGGHGPMIDLSVDEDNAKLLED
FYKSNKIVAAVCHGPGALVKAKLDNGDSILKGKNVTGFSNVEEEQVGKVKDIPFLLETRL
KELGGKFTAAAEPWGTHVVIDNGGKLITGQNPASAQLVGEKILEALKA
Download sequence
Identical sequences XP_007767727.1.51617 jgi|Conpu1|81856|fgenesh1_kg.5_#_403_#_isotig09634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]