SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|82294|fgenesh1_kg.6_#_284_#_isotig04300 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|82294|fgenesh1_kg.6_#_284_#_isotig04300
Domain Number 1 Region: 763-1080
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-90
Family Protein kinases, catalytic subunit 0.0000000348
Further Details:      
 
Domain Number 2 Region: 144-213
Classification Level Classification E-value
Superfamily HR1 repeat 0.00000000000000353
Family HR1 repeat 0.0071
Further Details:      
 
Domain Number 3 Region: 457-515
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000718
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0049
Further Details:      
 
Domain Number 4 Region: 240-340,408-432
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000164
Family Synaptotagmin-like (S variant) 0.053
Further Details:      
 
Domain Number 5 Region: 525-586
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000194
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|82294|fgenesh1_kg.6_#_284_#_isotig04300
Sequence length 1093
Sequence
MSELDQKIQDLYKRIQTERKVLEASQLLSKATSNPDVLRRNDAKIREAERSLSYFEDTLK
DLQARKRQEAQRSSGASSPSASRKTPHDRDRSLPQLPPEDTEGAGGLGSPGSPRGGFPDD
DADAPKAKQYSNLDLIKADTPHTTAKISRMLHQLEFKLQIEMQYKKSIDKIARLYQADGD
KKSRADAESKRVESDKKIQLLQTALKRYKNLHVLDDVEEEEDTPQEAGVDGERKENLRAK
PISGKLQVTVKGARDLDHAPIVTRSRSSSKQVTETYVSLKIEGTQKARSHPSRTDRWNEE
FEVVVDKANEVEIAVYDKQVSEAHPVPIGLLWVRISDLVEALRRQKVMNDTGQGGWVTAG
AMDGDSAGRPGSQQPGGFGDPNAFSFGGANPAGQFAQPPGAMGGGGGGQSEGIDAWFAVE
PAGALALHLNFVKELVRKRPMDAPGGLGRQGAVRKRKDEVHEMNGHKFVQRQFYQLMLCA
FCNDFLLNALGYQCEDCRYTCHKKCYEKVVTKCISKSNTAGDDEEKINHRIPHRFEPITN
IGANWCCHCGYMLPLGRKNSRRCTECDVTCHANCAHLVPDFCGMSMETANQLLRDWRDIN
RARGGKTAVPGRPSHAPSVTAGQQPYQPENLAQGVERLGLGGDGQVPAVDPYRQDPRYMQ
QQPSPVPRPPPGARVAVPPAYPNEPLIPPAGQSQRTSAYGEVPMQDEYSIPPSSKQPGYP
QPGAQVKPGPPGYPQSRPTPPPQEVALPAQAPPPPARRRKVGLDDFNFLAVLGKGNFGKV
MLAEEKATNALYAIKVLKKEFIIDNDEVESTRSEKRVFLAAARERHPFLLGLHSCFQTET
RVYFVMEYVSGGDLMLHIQRKQFSLRQAKFYASEVLLGLEYFHSQGIIYRDLKLDNILLT
LDGHVKIADYGLCKESMFEGATTSTFCGTPEFMAPEILLEQRYGQAVDWWAFGVLTYEML
LGQSPFRGDDEDEIFDAILEDEPLYPITMPRDAVSILQRLLTRDPSRRLGSKGDAEEVKG
QPFFRDVNFDDIMNKRIAPPYFPTINGSADTSNFDEEFTREQPTLTPVHGQLTARDQQEF
GGFSWVADWANTV
Download sequence
Identical sequences jgi|Conpu1|82294|fgenesh1_kg.6_#_284_#_isotig04300 XP_007768682.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]