SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|82319|fgenesh1_kg.6_#_309_#_isotig09865 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|82319|fgenesh1_kg.6_#_309_#_isotig09865
Domain Number 1 Region: 14-127
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 2.96e-23
Family Barwin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|82319|fgenesh1_kg.6_#_309_#_isotig09865
Sequence length 128
Sequence
MANISLFILSLLASLLLVLAVPLPNNVELNKRDYWGQGTWFNVGEGACGDWNQNSDSIVA
ISSDIYGDGGSCNQWVEVTNTQTGASAWGQIRDECPSCDSGSLDMSPGLFQKLGDLSTGV
LQIQWNFS
Download sequence
Identical sequences jgi|Conpu1|82319|fgenesh1_kg.6_#_309_#_isotig09865 XP_007768703.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]