SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|82551|fgenesh1_kg.7_#_53_#_isotig09670 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|82551|fgenesh1_kg.7_#_53_#_isotig09670
Domain Number 1 Region: 16-127
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 0.0000000000234
Family Barwin 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|82551|fgenesh1_kg.7_#_53_#_isotig09670
Sequence length 138
Sequence
MFCAALVLAASLAVVSVHAAETDPQTGDVFFFAPGLGACGYTNTSDQAVASVSQNFFNNY
PNATANPNDNPICAHNLTVTVGNTSVSAQIVDYFLSGFSDTSIGLSQSAFQTVANTSNGV
VSNVTWVVDPLPTNSSSS
Download sequence
Identical sequences jgi|Conpu1|82551|fgenesh1_kg.7_#_53_#_isotig09670 XP_007769216.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]