SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|83279|fgenesh1_kg.9_#_40_#_isotig00052 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|83279|fgenesh1_kg.9_#_40_#_isotig00052
Domain Number 1 Region: 5-508
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 2.88e-199
Family Heme-dependent catalases 0.000000000938
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|83279|fgenesh1_kg.9_#_40_#_isotig00052
Sequence length 528
Sequence
MPSKQVFSNKDGANYTTSNGAPIAEPYAAQRAGQIGPLLLQDFHHIDLLAHFDRERIPER
VVHAKGAGAHGYFEVTHDLSDITSAKLLTSPGKKVRATVRFSTVGGESGSADTARDPRGF
STKLRTDEGNLDWVFNNTPVFFIRDPAKFPHFVHTQKRDPQTHLKDADMFWDYLSRNPES
AHQVAIVFSDRGTPDGFHNMHAYSGHTFKLVKDDGSFVYTQIHLIADGGFKTLDGPTAGR
LSGENPDYGIQSLFETIEAGKYPSWTAYVQTMTPEQAEKFRYNILDLTKVWPHADFPMRP
FGKLVLNENPQNYFAEIEQAAFSPSHLVPYIEASFDPVLQSRLFSYPDTHRHRLGTNYQQ
LPVNAPIAPIANFQRDGAMAFSNQGPRPNYQSSIAPLTYQQNKFSIVGCVRDVEREVAHE
NFLAGAYLDLSEITELDFEQPRSLYQTVMNDTDRQHLIDNLAGHMGGIKSTEVKARTLSY
WASVDQDLSDAIAKAIGAPTAKPLPNVKPAAEAIRFKANIGLKSQLKL
Download sequence
Identical sequences XP_007770624.1.51617 jgi|Conpu1|83279|fgenesh1_kg.9_#_40_#_isotig00052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]