SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|83503|fgenesh1_kg.9_#_264_#_isotig04325 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|83503|fgenesh1_kg.9_#_264_#_isotig04325
Domain Number - Region: 939-963
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00017
Family Ran binding protein zinc finger-like 0.0036
Further Details:      
 
Domain Number - Region: 883-911
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00256
Family Ran binding protein zinc finger-like 0.0026
Further Details:      
 
Domain Number - Region: 829-856
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00271
Family Ran binding protein zinc finger-like 0.0031
Further Details:      
 
Domain Number - Region: 774-801
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00357
Family Ran binding protein zinc finger-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|83503|fgenesh1_kg.9_#_264_#_isotig04325
Sequence length 965
Sequence
MSGAVRRGDRRSARNAHASPYARPTKAFPPKKSSWGLPSLLSFLNPFRFGSNDTSPDSPE
DDSEEDKMGISEPGDEHSLSNHEHGTDTDTQRVNGPAQSLSQRGHQISRNLQDHTVRSAE
ASGSGRNGWQNPPNQSPFLSLTAVSSQASRNDNRPTTPLAQSLEPVTKFLAEKRGQPLND
FEAAGIFNYIQNVHSPEKPEPFRFSTTSSRDSSPGFTPGDVSGAPDNNDVAPAPRKTLSK
NPNGVYRWQGGGSSRPRNRYQSPAFRPRQPQPSIKLSPPKAVTDTKRRRVGEEAGSSQAQ
RTSLAPSKPFEREGSPGPASTPSPPVNGKGSSSSPSTSRVNGAQAPRLRTTGLTYTPSAP
AIPSPLRQTWKNGDSPPQSQSQITPPSKPTKAASFMSGLIKEVTPPKKLEVANPYQVACP
VKQPVRKPPPRRVKAARSVEQPKEPEPDVEMSAQAVIEATVPKGSKRSRPPPELEKPTRS
AFPAIEPPQPAVNGSSRVGRSAKPTVSVEEADNDADTGPKKKRKTSPPANEASRPVRSTV
TVEEIDDDASAKSKTGSSEPTRPSEVVEPGDEPPRSPVKRGSTPPGAKLPLGVKSSVPRE
PSKLRFSYQAADKSESGSDAEPSTEPVAPPAAEPAPVSTFLSAPAVAATATVAAPVAFSS
FQSKPVPEPIPSPPASAKAEPNVKVTISPKEVVLAMNARELPKYSFDLNMGSYDASPSHV
KAREAVLVLPASSLPTYDFSKPAPPPPAVAPSSAPKTFDWSGAGMSASKASSTETWQCAT
CMLQNPDSAKEKCTICEAPRPGAAPPAPKTNGFNWGASGMKAPSAPGGDKWTCSTCMLQN
PDSAKEKCTVCEAARPGAAPPAPKMDGFNWGAAGMKAPSVPTSNTWTCNTCMLQNPDSAK
EKCTVCEAARPGAAPAAPKVVGFNWGAAGLKAPPASSDAMWTCGTCMLSNPTNAKKCTVC
EAERV
Download sequence
Identical sequences jgi|Conpu1|83503|fgenesh1_kg.9_#_264_#_isotig04325 XP_007770906.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]