SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|83548|fgenesh1_kg.9_#_309_#_isotig03901 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|83548|fgenesh1_kg.9_#_309_#_isotig03901
Domain Number 1 Region: 1804-2134
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.55e-96
Family Biotin dependent carboxylase carboxyltransferase domain 0.00000000887
Further Details:      
 
Domain Number 2 Region: 1479-1800
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.42e-75
Family Biotin dependent carboxylase carboxyltransferase domain 0.00000000329
Further Details:      
 
Domain Number 3 Region: 164-418
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.63e-69
Family BC ATP-binding domain-like 0.0000000152
Further Details:      
 
Domain Number 4 Region: 8-163
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.45e-51
Family BC N-terminal domain-like 0.000000312
Further Details:      
 
Domain Number 5 Region: 429-546
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 1.31e-27
Family BC C-terminal domain-like 0.00000327
Further Details:      
 
Domain Number 6 Region: 673-746
Classification Level Classification E-value
Superfamily Single hybrid motif 0.00000000000288
Family Biotinyl/lipoyl-carrier proteins and domains 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|83548|fgenesh1_kg.9_#_309_#_isotig03901
Sequence length 2230
Sequence
MAAYDHSKVSHFIGGNSLDKASPGRVTDFVQEHGGHTVITKVLIANNGIAAVKEIRSIRQ
WSYETFGTERAIEFTVMATPEDLKVNAEYIRMADQYIEVPGGSNNNNYANVDLIVDVAER
AGVHAVWAGWGHASENPRLPESLAACKNRIVFIGPPGSAMRSLGDKISSTIVAQSADVPC
MAWSGSGIVDTVLSEQGFVTVPDKAYQNACVTTWEQGLAKAEEIGFPIMIKASEGGGGKG
IRKVESADAFKNAYYAVAGEIPGSPIFIMKLAGQARHLEVQVLADQYGNAISLFGRDCSV
QRRHQKIIEEAPVTIAKEDTFEKMERAAVRLAKLVGYVSAGTVEYLYSHADDEFCFLELN
PRLQVEHPTTEMVSGVNLPAAQLQVAMGIPLHRVRHIRTLYGLAPNAATEIDFDLVKPES
NQLQRKPRPKGHVVAVRITAENPDAGFKPSSGALQELNFRSSTNVWGYFSVSSAGGLHEF
ADSQFGHIFAYGEDRNESRKNMIVALKELSIRGDFRTTVEYLIKLLELEAFTENTFTTGW
LDSLISNRLTAERPDATLAVVCGAVTKAHLAAEACLSEYKKILDKGQVPVRDLLKTVFSV
DFIYENVRYSFTATRSSKNMWTLFLNGGRTLVGARPLADGGLLVLLDGRSHSVYWREEVG
ALRLMVDAKTCLIEQENDPTQLRSPSPGKLIRFLIDSGDHINAGETYAEIEVMKMYMPLV
AAEDGVVQFVKQPGVSLQPGDILGILTLDDPARVKHAKPFEGLLPPMGLPGVVGNKTYQR
FVRCFTTLNDILDGYDNQSIMASTLKDLVDVLHEPELPYSELHAILASLSGRIPAKLEES
VRSALDVAKSKGDTLDFPAVRIKRVIDHYIQDNILAPNQTMFQNQLSGIYDVLDRFTNGL
KGHEVITIAKLLSRYEETEKLFGGSIEARVLSLREQNKDDLDKVVATVLSHTKAQSKSKL
VLALIDYVKTSGLPVSNTESPLYQVLNDLAALESKSSTSVALKAREVLIYGQMPSYEERL
HQMEGVLKTSVSASYYGEQGARRTPSADTLRELSDSRYTVYDVLPAFFLHKDPLVTLAAF
EVYVRRSYRAYSLLSIDYEEGDGLDDGELPSAVTWRFNLGQSHSPPATPGMNATADPRRQ
GSVSDLSYLISRSVSQPVRNGVIASFADINALTRGFEKAANLLPAFDPEEHNQRYNTTEP
PNVMNLALRIFEQPGDLSEEAWSEQLSQFINERKSILTRRGVRRVTFLVCRPGVYPKYIT
VRESDGEWVEEQAIRNIEPALAFQLELSRLSNYNLQPLFVETKQIHVYHAVARENQLDNR
FFIRALVRPGRLRGTMSTAEYLISETDRLVTNILDALEVVSAQYRTADCNHIFMNFVYNL
AVTYDDVLEAISGFIERHGKRLWRLHVTGSEIRIALEDNEGNVTPIRCVIENVSGFVVKY
HGYQEILTDKGTTILKSIGDKGPLHLQPVHQVYPTKESLQPKRYQAHNIGTTYVYDFPEL
FSKALQNVWIKARDLSPSLVLPKKFLDSKELVLDEDDNLVEVDRAPGNNTFGMVAWVYTL
WTPEYPQGRSVVVISNDITYKIGSFGPIEDQFFYLVTKYARVHGLPRIYLSANSGARIGL
AEEIMHLFSCAWNDPQQPDKGIDYLYLTRESYLKVEEKASGAVRTAEIEVDGEMRYKITD
IIGLQDGLGVESLKGSGLIAGETSRAYDDIFTITLVTARSVGIGAYLVRLGERAVQVEGQ
PIILTGAAALNKVLGREVYTSNLQLGGTQIMYKNGVSHLTASSDLEGVTHILDWLSYVPN
IRGERLPIRETPDSWDREIGYTPPKGPYDPRWFIGGKTDEQSPLWASGFFDKGSFQETLS
GWAQTVVVGRARLGGIPMGVIAVETRTIERIVPADPANPASFEQRVMEAGQVWYPNSAYK
TAQAIFDFNRESLPLMVFANWRGFSGGQQDMYDEVLKQGSKIVDGLSSYKQPVFVYIVPN
GELRGGAWVVLDPSINMAQMEMYADVDARAGVLEPEGVVEIKMRRDKILTLMERLDSSYA
ALKVKSKDTSLSAEDRAHASQALFARETLLQPTYKQLALLYADLHDRSGRMEAKGCAKPV
VWKDARRFFYWALRARLARSNALAKIAESSPESEPEYHAEVLDSLVPVDSSDNRVLAEAL
EKLDLTETLAKLRTDSFLHRFAEVAQYNRKTTLEGLARLIDTLSDDERQAVQSALQSGNR
SPGPPSYSTA
Download sequence
Identical sequences XP_007770956.1.51617 jgi|Conpu1|83548|fgenesh1_kg.9_#_309_#_isotig03901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]