SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|83597|fgenesh1_kg.9_#_358_#_isotig04237 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|83597|fgenesh1_kg.9_#_358_#_isotig04237
Domain Number 1 Region: 552-812
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.17e-85
Family Protein kinases, catalytic subunit 0.0000000155
Further Details:      
 
Domain Number 2 Region: 449-517
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000000654
Family beta-sandwich domain of Sec23/24 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|83597|fgenesh1_kg.9_#_358_#_isotig04237
Sequence length 834
Sequence
MSTQGTINQRAAQHHNHHHSSSQATNKRHSKITIEYHRPSRESIQEYSDLLKGANLTASG
QQYTSYSDPYSRDVYTPARQAPPPPQGHASGFRHKQQSVDVTSPSTASPSPSRIRQSYQK
PPQSRQRRDSLPSVASQQNPHPGAQQPQLHISTQVQQSQAQPSPFATQSKPSGMTSPPPR
PSRANTATLNDIFPTQSQLASRRLSVPSMTPPPDHFTADPSEMMPPLPLMETPPAGAAGT
RSRSGTAATKSKKGMLGFMSDFLNTSKRPEISTPYDPVHLTHVGFNSSTGEFTGLPKEWQ
QLLQESGISRSEQERNPQAVMDIVKFYQEGHGDVWDKMGHADTSHMLPKTPVDDGLSNPR
PAPPPPKKPQRTPTQSQSILPTPPASYRPAPAPPSPAQPSLDRSTSQRAPQRQPKTPELG
RSNTTTTKPRRSPNLEASGDGAGHQLDAPRPPQKQPSPGSSQTDLAIKQQQYQKQQQQQQ
QQQQQQQQQQLAAQQAQRDQQARAAPQGPPSPAVQSLAKTAGVATPRRREKKEKDKDKED
DIIRRLQAICSDADPTKLYRSLVKIGQGASGGVYTAYQVGTNMSVAIKQMDLDKQPKKDL
IINEILVMRASRHPNIVNYIDSFLHKNDLWVVMEYMEGGSLTDVVTANLMTEGQIAAVSR
ETAQGLEHLHRHGVIHRDIKSDNVLLSLNGDIKLTDFGFCAQISDPASAKRTTMVGTPYW
MAPEVVTRKEYGPKVDIWSLGIMAIEMIEGEPPYLNQNPLKALYLIATNGTPTIANPEAL
SPVFSDYLKRTLEVDAEKRPTASQLLEHPFFKLCEPLRTLSPLIKAAREIAKNK
Download sequence
Identical sequences jgi|Conpu1|83597|fgenesh1_kg.9_#_358_#_isotig04237 XP_007770999.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]