SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|84058|fgenesh1_kg.11_#_45_#_isotig08531 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|84058|fgenesh1_kg.11_#_45_#_isotig08531
Domain Number 1 Region: 8-239
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 7.33e-19
Family DJ-1/PfpI 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|84058|fgenesh1_kg.11_#_45_#_isotig08531
Sequence length 241
Sequence
MSSQNKLRVLCLPFPNFDTLDLNGPIEVLGSSGYPGGKFPFSITIAAADELTRAGEGYAL
QRNISHADALATINSFAVLLVPGAGTEHIMPYLKEGETHFDGLLGIAEAFCRLGPMEDGT
ERVMLSVCTGSLKLAYRGLFDGLKVTTHFSAYSLLEGIVAGYKGRNPGTAKGATVVGPVE
GKERRVRWVDAGRNAHGVRVISAGGVSCGIDAALFIASERYGRDTALKIAEIMEYAWREN
V
Download sequence
Identical sequences XP_007772015.1.51617 jgi|Conpu1|84058|fgenesh1_kg.11_#_45_#_isotig08531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]