SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|84171|fgenesh1_kg.11_#_158_#_isotig09448 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|84171|fgenesh1_kg.11_#_158_#_isotig09448
Domain Number 1 Region: 21-218
Classification Level Classification E-value
Superfamily Osmotin, thaumatin-like protein 1.05e-16
Family Osmotin, thaumatin-like protein 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|84171|fgenesh1_kg.11_#_158_#_isotig09448
Sequence length 225
Sequence
MSSARAFSLAALAAVVSAQSLNVVNKCSDSVTLFTQTSFGTIDNNVNVAAGATTDMNISN
NWDGAINVGTSSTGGPTWDGTTPFSRAEFNFYAVPGSVTYDISLIYGYNVGMEISSSDSG
CSAFACTLPSGCPVPGPDGSCYSPCCSSVSACSGGALPAGGGGCTSNAGPGPNSPFYYNS
CYNAYAFPDNDGAAGYTPADNVDFTCGNTDITLTLCPGTTSNIPK
Download sequence
Identical sequences XP_007772173.1.51617 jgi|Conpu1|84171|fgenesh1_kg.11_#_158_#_isotig09448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]