SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|84906|fgenesh1_kg.14_#_124_#_isotig01970 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|84906|fgenesh1_kg.14_#_124_#_isotig01970
Domain Number 1 Region: 230-420
Classification Level Classification E-value
Superfamily MoeA N-terminal region -like 3.92e-35
Family MoeA N-terminal region -like 0.0000689
Further Details:      
 
Domain Number 2 Region: 419-577
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 1.31e-34
Family MoeA central domain-like 0.0000721
Further Details:      
 
Domain Number 3 Region: 5-163
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 1.57e-33
Family MogA-like 0.00022
Further Details:      
 
Domain Number 4 Region: 585-665
Classification Level Classification E-value
Superfamily MoeA C-terminal domain-like 9.55e-18
Family MoeA C-terminal domain-like 0.00053
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|84906|fgenesh1_kg.14_#_124_#_isotig01970
Domain Number - Region: 185-240
Classification Level Classification E-value
Superfamily Ribosomal proteins L15p and L18e 0.085
Family Ribosomal proteins L15p and L18e 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|84906|fgenesh1_kg.14_#_124_#_isotig01970
Sequence length 672
Sequence
MTSPATVAVLTVSDSISAQGDDKQDKSGELAQTIATNNGFQVARKEVVSDNINEIRAHVK
RWSSSADSEHVDWIITTGGTGFGVKDCTPEAISPLVEREASGLVHLMLSTSARHTPLGLL
SRPVAGTIGSTLVTTLPGSPKAVSQILEGFFEQGLIHHVLDLLRGGSGKTLHSQMQGQGG
SHGHHHHNHGHGHGHGHAHHHGHGHVAPKPRTNFSHDPSMPATARHRVSPYPIISLEDAL
QHIFNETEGLGTEKVTVDVMNSNGNASLIGSVLAEDVYAPTEVPSTKTTSVDGYALRSTD
PPGVYKVLTSNTHPLNKELPQGTVFRINTGGPLPAGTDTVIMVEDTEIVSTIKDADGKDV
EEDEIKTLAQVPEAENVRHPGSDVRKGDLVLAKGAVITSVGGEIGTLHFVGRKEVEVFRR
PVIGVMSTGNEIDDLFNRNPEKKEEGWPEIWDTNRPSLMATASEMGFAVKDYGIVQDTID
AVVNALKSAFSTTDIVITTGGTSMGSTDLLKPVIERYFDGAIHFGRVAIKPGKPTTFASC
TYADRRKYIFMLPGNPASALVTFHVFVVPALRKMSGWRHDQCQLPRIRVKLLDPMRLDPR
VEFHRVTISVTRNGEFLARSTGGQRSSRMASLSRANGLVVLPQKTENGPTELAKGETADA
IILGELQTEPST
Download sequence
Identical sequences jgi|Conpu1|84906|fgenesh1_kg.14_#_124_#_isotig01970 XP_007773516.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]