SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|85222|fgenesh1_kg.15_#_185_#_isotig00194 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|85222|fgenesh1_kg.15_#_185_#_isotig00194
Domain Number 1 Region: 50-204,243-881
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.78e-268
Family Motor proteins 0.00000000000191
Further Details:      
 
Domain Number 2 Region: 1271-1388
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000889
Family Myosin rod fragments 0.0047
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|85222|fgenesh1_kg.15_#_185_#_isotig00194
Domain Number - Region: 25-57
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.000215
Family Myosin S1 fragment, N-terminal domain 0.0058
Further Details:      
 
Domain Number - Region: 2027-2102
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00785
Family Myosin rod fragments 0.0078
Further Details:      
 
Domain Number - Region: 1906-2019
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00994
Family Myosin rod fragments 0.006
Further Details:      
 
Domain Number - Region: 1748-1845
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0254
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number - Region: 2109-2186
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0262
Family Myosin rod fragments 0.0053
Further Details:      
 
Domain Number - Region: 1671-1740
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0392
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number - Region: 2200-2298
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0549
Family Myosin rod fragments 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|85222|fgenesh1_kg.15_#_185_#_isotig00194
Sequence length 2331
Sequence
MPAPRMSQSAEAARAAALQAEFNEKKWVWVPDDKDGYLAGWVHQEDSDFAQVVMASGGEI
RQVPLYALSKLNPPKFDRVDDIADLTFLNEASVVHNLRLRYGSGVIYTYSGLFLVAVNPY
QNLPLYSDTIIQQYRNKRRDENPPHIFAVAERAWINMGEERENQSILITGESGAGKTEST
KKVIQYLSAIATDVHLPASSHTQQPSISSLYNSPPAGAPRNSQFRRSLQASQSGGSSLTS
RGRLGLLERQIIQANPILEAFGNAQTQRNNNSSRFGKFIRISFAPDGSISGANIDWYLLE
KSRVVVRSEAERNFHVFYELLMSNNESLKKSLLLDGDVEDYEYLNKSRREVDGVNDKDEW
DALINAFDTVGFSSHEQLDLFRIVAAVLHIGNIVITSTKADDAVLPDPSQAERACHLLGV
PVAEFTKAILRPKVLAGREWVTQARTRQQALEELASLCKTLYEKSFGALVDRINRALDRP
SSKSTFIGVLDIAGFEIFDVNNYEQLLINWTNEKLQQFFNYHMFVLEQEEYAREGIEWDY
VNFGLDLQPTIDLIEVSGPTIGILSCLDEECIMPKATDLTFTNKCHALWSGDVRTGEEPH
PGREKYSPTRFAQGFVISHYAGKVEYRTDGWLEKNKDPLNDNLGRVLAASSDSYVASLFQ
EHAGGYVDVNGNPNPFTVGKKRGIKKGAFRTVAQRHREQLSLLMAQLQATQPHFVRCIVP
NGNKKPGRIDVPLVLDQLRCNGVLEGIRIARLGYPNRLPFVEFRQRYEILTPGIIPRGYM
DGRKACLRMVEALELDDGIYRVGTSKIFFKAGVLAELEERRDSLLFDIFSRLQAVARKYS
ARRQMKKVLNRAVAIRTIQKNARVYGELRDWPWWQLYTKVRPLLAATRNDEELRRKEVEL
QLARERAERDQRERETLENLKMGLESEKRKVEDELEAERALALDKDALLERSKKRESELE
EEITALHADLDVLDSQLDRALKMQKEGEEKHEALRLAFDQAAEHLVRMEQDQNSNKVKEE
ELMTTYATTQQELGDIQEERERLVKEKEDLQALLTVHEEDLARVRERADAAHGELIAKLT
EERRNNDAANDKIHELEQTFRQSKEQISEMNRTANEYSAMIQQKEDVIAGISRDLAAVRS
ERSQFQKETFELQNKIEIAKAEAETAKEDAQRSAASRTKLQEELDELRTLMETKTSEETR
RMEVEKSKEMELSNLRSQVETLQTDLSTTRNSAAENERKLRAELEEAHRERASLEESHKS
LTGRERSMQSNINRLETINSELEKTKRSMESELARFRSRQVELDSQIADATKTKDSLSRQ
LSQAQSKAQDFEDANLQLERQIGQYERQMESTRKQLEAETAKRQQLQTVASSQKTELVTT
KEKLAKFEEELNKTLKDLKNKEWECRQLESKQDKTIVEHVHVLEEAKRVTDKQLSTAQQE
LQKNATYIRSLEKARNKLMREAEDSSLETRREQLEFRAAEKNAQLNAERAEKAIARAESE
KKAKEAAELQVRRLQSELHTAHAELEGRTDELLTAKRSKEQLENELAHLVDEMPMSDARN
NTSKEAEQRIAELERQLADATSSEVVLAQIQHRVDQQHRELRALIMKDAPKNDSFRKRLM
QELQAADEALAKEVKAHIQQKPSRNVHFNLPPSPAPKKAPRPSLTDPKPDRQNDELKQQV
QTLEIRIEASERVRQHYESVIRDMTSDLENINDAKEFLQKCRRRLSEENARLSTMLDEEA
NVRRTAESSEDVQAVWAKFRATLDEEQLAYGRLEESRKALLVQQRNTQAELEEAKKGLRD
NTHSKKRMQAELEAFKEALETEKIRKNEALDASRGAQAKLQELQVDSGASIAMQSELRAA
MEAYRQKSETMAKRADEADIAKEKATRTESLVRRSLADAEKALGAATSEKNNLQSRLEKT
ERRLLELEKKLHDEGEESSELSGTRQRLFEQLQEERQLHQKDLAERDFASDQTRKKYQAE
LAQLSDELQSQRDTMSRLREDNRKLRSDYDDLQLRFDDEVYNGGAWKKEKERYETKIDDL
TKAYESSVTAQSDQQNQIVSLHSQVRELRGVLNDAEADRALLQKARRALQAELESIKLDH
ADTSKMANDTEFQKLLLQKQDLKRSLEEQEDRTTMAFERLKKAEAYANDCQAELNQTRGE
NTELERMNGNLEKQIKDLKVTIVDLETRSYSSSPQPSTVMRQLQERIADLTKQLHESQSG
TQRRMSSDKMMREAQNQLAESQRQRIRLEEERHAFEAQLAALRQDLDRTQTDGRNLQRDK
RRVDREAADFKQKALNLEREVERLRGRVSRPSSVVSSVVSALNGSSRKSES
Download sequence
Identical sequences jgi|Conpu1|85222|fgenesh1_kg.15_#_185_#_isotig00194 XP_007774042.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]