SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|85567|fgenesh1_kg.18_#_11_#_isotig10597 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|85567|fgenesh1_kg.18_#_11_#_isotig10597
Domain Number 1 Region: 42-117
Classification Level Classification E-value
Superfamily Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 5.49e-23
Family Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|85567|fgenesh1_kg.18_#_11_#_isotig10597
Sequence length 118
Sequence
MSFSSFFSSFLPTVYADAPEEKEETKNDAKEEEPTEDATEDAAAEEEEEEEPEDPQPEIR
EECKATSKCAPLTKHFEHCQEKVNAGEGYKGEDCVEELFHMMHCVDQCAAPRLFSKLR
Download sequence
Identical sequences XP_007774831.1.51617 jgi|Conpu1|85567|fgenesh1_kg.18_#_11_#_isotig10597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]