SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|85781|fgenesh1_kg.19_#_73_#_isotig02932 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|85781|fgenesh1_kg.19_#_73_#_isotig02932
Domain Number 1 Region: 56-151
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 1.81e-22
Family Barwin 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|85781|fgenesh1_kg.19_#_73_#_isotig02932
Sequence length 152
Sequence
MYAPITATWILPLFLSLLALLGTALGAPAPLVLPSEVDVKANANATATAKSELESRQYYS
EQRLTYYEPGLGACGWESTADQWVVALSVDMYGSGGYCGQSVTINYNGNQQTATVVDECE
ACPYGGLDLSQGLFGSLAALEVGVIYGNWWFD
Download sequence
Identical sequences R7SFV4
XP_007775226.1.51617 jgi|Conpu1|85781|fgenesh1_kg.19_#_73_#_isotig02932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]