SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|86721|fgenesh1_pm.1_#_601 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|86721|fgenesh1_pm.1_#_601
Domain Number 1 Region: 235-561
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.35e-55
Family Histidine biosynthesis enzymes 0.0000000392
Further Details:      
 
Domain Number 2 Region: 4-210
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.67e-46
Family Class I glutamine amidotransferases (GAT) 0.00000842
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|86721|fgenesh1_pm.1_#_601
Sequence length 565
Sequence
MSLYILDYGAGNVQSLANSLTRLGYAFEWISTPDDFHKASSIVFPGVGAFHTAVEHLRAR
ALWDPLRQYIQSGKPYFGICVGLQVLFQSSAESPGSIGLGIIPSPIQRFDDTSKAVPHMG
WNTAQLFPSEPSSSSSSITSPSNHYYFVHSFRAPYDPEKYPEAASWAHATTQYGQEVFIS
VVRRGNVFGTQYHPEKSGQAGLDVLREWLDQTDVQRTAAPPTNPIPRPPQPRDGLTKRVI
ACMDVRSNDAGDLVVTKGDQYDVREKPNQGCPSSTALTQETAGTVRNLGKPVVLAERYAA
SGADELALLNITSFRRSPLHDQPMIAVVRAAAARVFVPLTIGGGITDSVDPDGTHRPALE
VAGAYFRAGADKVSIGSDAVRAVERLRANSNVLDGTSAIETIARAYGNQAVVVSIDPRRA
FVDPGYTGPHAGEIVRGGPGDGEDADKAWWYQCTVSGGREARDLSVVELAQGAEKLGAGE
LLVNSIDRDGTGRGFDHALLSLVRRAVRIPVVASSGAGSAAHFVDVFRETGVEAALAAGI
FHREEVRIEDVKRALADAGISTRAS
Download sequence
Identical sequences XP_007763441.1.51617 jgi|Conpu1|86721|fgenesh1_pm.1_#_601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]