SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|87650|fgenesh1_pm.2_#_421 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|87650|fgenesh1_pm.2_#_421
Domain Number 1 Region: 972-1238
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.05e-81
Family Protein kinases, catalytic subunit 0.0000161
Further Details:      
 
Domain Number 2 Region: 82-150
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.43e-17
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|87650|fgenesh1_pm.2_#_421
Domain Number - Region: 384-450
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0102
Family beta-sandwich domain of Sec23/24 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|87650|fgenesh1_pm.2_#_421
Sequence length 1248
Sequence
MAAATISSLNPQSLDSLASKSSSPTSSTTETTPADQTLSSSRSFINLSSPPRSHYPFPTA
SMSSTGSTILDPPHGQPFADYLRTWSDSHVARWLTEIKCSAHTNKFRDNDIRGDVLLEID
QDTLKEMGIHSVGDRLRIVNGVKALRQRCSSRSTLADPFRARLLSDSGRDVPGVNGVDGS
HSRSSSRDDSRDSSPNSRVNARRLESVRPAPLVLSSNTARNDLPRLIREPGSGDSRESSR
TTPPPIRPLPQPAPSSFSNFSSGSTSRPQLPPLPPAPRGQPPQPPTGRANTRFHPLSGPR
ARTPNQADATPFANSPLPPAPSQGILTPQSSTPQTGGWAAYGLPSDPRAGMKQPQVRSPS
PLGSGAPARSNAAHNRNISFGGVSSPLSSTPTGKLPPRPSTTGNNSHPYASAQPSPQLQP
QPSTSQTLHPGSNQNQPILSPIAESFASTNSSSPGSSSPPTGFSVRRGPFNPASHINNPS
DARHKLIKFVLPDEGRSAVVDVADCFGGVEVMEKVLRKFDKLSSRKNDSNIMSRVETDEG
GLSVDGWSVCLEYEDNHDIQALSEAELLAICHSPIDEIMKDHGLYLRKTGRGKRSKALAR
IFGEEVPAPIPRNVSPTSPAVPSRPSPSADDDDTPLSAFNLPDSMGRSKAIKRASTISIL
SGLGVRDPEKALESPPSPSIPASATLTTPVAAKKPSKLRNFFGQRPPSELITNHLTEYFP
LAEKKALRTARHSMMLRSSSVHGKRDSTISMNPPLPSRFSISTQGSGSQRRSSSPTRTNR
NSMASSTSIFPDRSIRDSQEHVLDEPPRLSVSNEDGRSVILTGDDVDKLSTTDKQPQLPP
VAFPTESLSESMEDLTAPDPSKAVSRTSSNASRRTSHLSELRSKRDKSDTASLLTVDEIT
AEVENRRQSMAVDMGVEGAEDWTKVEPDIDEMSEYMEAELEEEDEEEEEEEEEGEEEEEE
VGQTMTSETGTKWIKGALIGAGSFGKVYLGMDAENGLLMAVKQVELPKGTAPNEARKKSM
LDALEREIDLLKELQHPNIVQYLYSSNDDDYLNIFLEYVPGGSVAALLRSYGAFEEPLVK
NFVRQILQGLNYLHERDIVHRDIKGANILVDNKGGVKISDFGISKKVVEGNLLTTKRNRT
SLQGSVFWMAPEVVKQTAHTNKADIWSVGCLVVEMLTGEHPWSQLTQMQAIFKIGQSIKP
TIPSDISADAQDFLAKAFDLDHTARPSATEFLQHPWLAAKKSKAPARV
Download sequence
Identical sequences jgi|Conpu1|87650|fgenesh1_pm.2_#_421 XP_007764731.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]