SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|88296|fgenesh1_pm.3_#_183 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|88296|fgenesh1_pm.3_#_183
Domain Number 1 Region: 398-703,752-838
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 3.11e-182
Family alpha-subunit of urease, catalytic domain 0.0000000012
Further Details:      
 
Domain Number 2 Region: 269-447
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 4.08e-65
Family alpha-Subunit of urease 0.0000193
Further Details:      
 
Domain Number 3 Region: 137-263
Classification Level Classification E-value
Superfamily Urease, beta-subunit 2.75e-48
Family Urease, beta-subunit 0.0000684
Further Details:      
 
Domain Number 4 Region: 1-105
Classification Level Classification E-value
Superfamily Urease, gamma-subunit 5.49e-39
Family Urease, gamma-subunit 0.0000786
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|88296|fgenesh1_pm.3_#_183
Domain Number - Region: 697-747
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 0.000216
Family alpha-Subunit of urease 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|88296|fgenesh1_pm.3_#_183
Sequence length 838
Sequence
MHLLPREHEKLLLHQTGFLAQKRLARGLKLNLPESIALIACQLHERIRDGIHDVARLMHH
GKTMLGRRHVLPSVPSQLHEIQVEGTFTDGVFLVTVHDPVCTEDGDLEAALYGSFLPIPS
QDNFPIGDVSLYSRDKLPGAIIPKKERVLINRGRRRVQLRVTNNGDRPIQVGSHYHFIET
NPSLSFDRLLAYGMRLDIPSGTAVRFEPGDSKRVTLCEIAGLKVITGGNGLATGVVDLRR
SDEIIANILARGFAHAPEPGAQEITVDSDLSRASYISMFGPTVGDRVRLGDTSLWIEVEW
DKTEYGDEVKFGGGKSIREGMGQATNRRSADTLDLVITNALIVDWTGIYKADIGVKGGRI
AAIGNAGNPDVMANVHPSLVIGSSTEVIAGEKLIVTAGAIDAHVHYICPQQVTEALAAGT
TTMIGGGTGPSAGTNATTCTPSPFYMRTMLAATDGLPMNFAFTGKGNDSGPTALEDIIKA
GAAGLKLHEDWGSTPASIRSCLDVGDKYDVQVNIHTDTLNESGFVQSTIDAFGGRTIHTY
HTEGAGGGHAPDIIVVCGLPNVLPSSTNPTRPYAQNTLDEHLDMLMVCHHLDKSIPEDIA
FAESRIRAETVAAEDVLHDNGAISMISSDSQAMGRVGEVVSRTWRTASKLRDFRGPLAGL
GDEPGRDNGRVKRYISKYTINPAITHGIGHLVGSVEPGKLADLVLWKPENFGAKPEMVLK
SGVIAWSQMGDANASIPTVQPSYGKPMWGSYPTAAALNSISFVSKFSIDSGTVASYRLSK
RFEPVINCRNITKRDMKWNDSMPQMGVDPETYEVTADGEHQTIEPATMLPLGREYNLF
Download sequence
Identical sequences jgi|Conpu1|88296|fgenesh1_pm.3_#_183 XP_007765772.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]