SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|90112|fgenesh1_pm.6_#_153 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|90112|fgenesh1_pm.6_#_153
Domain Number 1 Region: 166-312,675-781,814-864,963-1057
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000000000982
Family Armadillo repeat 0.035
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|90112|fgenesh1_pm.6_#_153
Domain Number - Region: 38-94
Classification Level Classification E-value
Superfamily HR1 repeat 0.000131
Family HR1 repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|90112|fgenesh1_pm.6_#_153
Sequence length 1266
Sequence
MPTSTDHDVSQATPPSNASVASSTLITSESDSASTKLPEDKLDALNVLLAREVRIKEGAE
KLLNLELPEHMRLKVQTELKMATLEIATLSQKIDLEDFRTALSQAQSCIQSLSGLGHSAI
SPPVTSLSSGTSQSANGPDVDRNRIDLQNRLGNILRRNIRVCYELDVTELLQAVTPSLAD
KCSTQCRTSAYRIMRLALVNVASLEEISKQPIDWYIVRTLSRDNKHEKEKEQVIKLIRAV
LDVVSENRDRRGAPGTGVVPLSEPVMRAFIAVAEHAEEPLRLICIQTLAEMVLLDIDLVA
RTGGIRFLLHALGEGPIELAPLLAATFLHIVDSPKTRCYLRLGTDLEIALSPFTDAYGRG
PDHADRMRGSAKVIQLMLRTWSGLMYFCMDQQQAIRSIVDTLRIPSMDTREIVLDFFFDL
LNIQASDWYKAFIDGRRLTMYRKSRIQPSERLLPLPTNEHTPESLKLTDQYIALLVLVFT
DAGLIDALTGMLEECATSSSLSRKATLLMAEVMQIANRVLPLPTASKIQAIPRVFDLASE
YGRGESRIIGTSALSQIDSFNRNRGRLQTTFINGRPRANSSEEAVRRGQRQVEQAKLKAN
MQMDDKTFQTSLLETQVTLTKDHTKWHFDILQELIEGPFLNPKRLEEAIKVARFMKRLLS
FYHPFSRRFSDLPKNSTNQRWIRLGCSLLNTLLASPEGVRYLMTEDDLLKQIVKAFMQLM
PGVHLGDIEPYFSDHKMRTTLTFGYFELLGTLSKHPDGIDLMEKAKVFTALYNLTEIRGR
EDIMKLVIEHLDYSLDGHSRLILSKTLTTGGLNLRRFTTRHLAGMVQSSAAPVGWMLRML
VTQLYDPLPEVCQIAVQTLEEVCDDMDTLQLVVEMQPTMDHLGPIGHPLLLKFMSTSMGF
RYLYDANYIQAEMESWFHERNLEYVVQVEIFLAKVFSSDVEYSADALPFDGAVPAHFYGE
LSKTELGCQVLEEKGHFLEFCSSIRDHALESEDVELILKLKSILWAVGSIGATARGLSFL
VEAEIIPDILKIAEQSLIPSVRGTCFFVLGLISSTPQGVDILDDCGWEATLSPLGFPTGL
CVPVDLDKFISMPAWDVIEPKKDARSGLLPPISQHEVEVMTVIDNLSNTVIANAASRSLA
KMKSRPEYRHVFSSPATFYRALHTISNYRYRLPVRRYILDLFTLELDASLVLELAEQAIA
LRAPLSSTATMPKAPVRRVVSMFGPNRGYSESDDEEDESDEETEEAVDRQPVITLRPVSR
LIGFDS
Download sequence
Identical sequences jgi|Conpu1|90112|fgenesh1_pm.6_#_153 XP_007768489.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]