SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|96390|estExt_Genewise1.C_1_t60202 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|96390|estExt_Genewise1.C_1_t60202
Domain Number 1 Region: 285-310
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000129
Family Ran binding protein zinc finger-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|96390|estExt_Genewise1.C_1_t60202
Sequence length 349
Sequence
MSQTFVKSFTHLKGRPHEARALQFLQTVASLVKPIMRKHGWTLPALSEFFPSNPSLLGLN
INGGQKIFLRLRPAHAPDTFYDEDHVVRTMLHELTHNVHGPHDDKFYKLLGELEDEYDAL
RRSGYAGEGFFSKGQRVGANVSHNVPIHLGRAKALEAAEKRRKVGEMMSGGGRLGGKPGA
SKLTPREAAAQAAERRKHDEIACGTGIDAQREAEKAARESVMDKVVIDLTEDSDEFTPVV
SSIGSGSSMKVVSNEASSSRTFSDAPSSKKRRVEFVPMADVAKHGEWTCHTCTLVNQPMA
LQCDACLSERPQDHSRGWTCMSCGESDNPHQFWSCKFCGSIKTESTAVG
Download sequence
Identical sequences jgi|Conpu1|96390|estExt_Genewise1.C_1_t60202 XP_007763723.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]