SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|98128|estExt_Genewise1.C_2_t30387 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|98128|estExt_Genewise1.C_2_t30387
Domain Number - Region: 506-567
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0837
Family Myosin rod fragments 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|98128|estExt_Genewise1.C_2_t30387
Sequence length 649
Sequence
MSDILRRSTLHNSVDPYAGARSGIPMPSTIKKPAHQSSMRMSLAGGGMRPPLYPPSGAVP
SSNPRQSMLRSQNANPLLQSSTKQNYGRTPMSNSVRRGSVWGGNALVAGPSGSQTMKDPR
PIRERSFQAKMRSEIFTWLQATEYDIAPSTLTNITGKDYRAIFHHLVQMLDPFYPFDQRL
RFEDEFQPCLRAIKYPFASSIDNKWLAAPGSMHSWPALLAVLYWLVEMGKARLHYLESDD
PTLQIPEKVPEEFTDPIHHQTLAFEYFSEAYVAFFHGADVFEDQERTLEEHYGRKNETTV
TELAKENALLEQLRSEYEALQSAAAPLEKVQKDHGFLISDRAKFQDCLQRFEARKSHLID
TIAYEKAELESRSSTLEQLKAEQQRLSDVVKEQNLSPEEVIRMNTDHETLTRSLEDLRHK
ISETHKTVMSLEVSMTNRAAAAEETLDAYINLLNNLGLLPHVNTPQGDIDLVLQLNTATT
NPHQMLVGADIRKIIKPTLSTIAESKRSERADVESERIKVDNELDQLTLECENVDEEVGE
TEKKVAGLNEQADDLRDAAQQESGLSNAEASRLEKELAHARTAALSSGMGAKSRLQALQF
SYREQVTKVAKVKDETIRAIAKNSHDIALFKEEVSAQLRHLKEFVEEGS
Download sequence
Identical sequences jgi|Conpu1|98128|estExt_Genewise1.C_2_t30387 XP_007764790.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]