SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|98336|estExt_Genewise1.C_2_t40143 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|98336|estExt_Genewise1.C_2_t40143
Domain Number 1 Region: 442-788
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.16e-57
Family WD40-repeat 0.00036
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|98336|estExt_Genewise1.C_2_t40143
Domain Number - Region: 7-46
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00012
Family beta-sandwich domain of Sec23/24 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|98336|estExt_Genewise1.C_2_t40143
Sequence length 790
Sequence
MLGSLQHLQPNPQQQQQQQQQQQNTQQQQQQQQPGSIPPPPPQNGQDFTLSSVLHFLQTE
WRRYERDRNEWEIERAEMRARIALLEGERRSFENVKLDLMRRIKMLEYALRMERSKQLSQ
PASQSVPPSKLAILQAQGSSSQKDEGSHKEGSSGSSPRSEDSPLPPEGRMGNGVAPGRPP
SWAGSNWQAGPPGAHGPLGKPPPGRDPKNRARSRDYLKQCLQEISYLTSPQAMNPLPNRP
LLNNSSLPLALPNVPAFDQIYNGRPRKMMPEAGKEFPVMNGMNLMSGPSSAPASGQLERS
NPLGSMFQNPNGQDGQNNGQGNMPQRPASAQQGQPPPQQQPAPQQPPPQVPSQQQKPMRE
DDNFEANQTTAIFRPDDKGEWREKLRSSYEQQLNRGFGDERGEQLSGVSSWDRRVREEDE
ETKEETDLDDDDATAIGEEGAKTWKAKRTFRNHLDAVRALAFHPNELCLATGGDDCTVKI
WRMDVSSLTSSAARPTTEVEPQLTLRGHSAAITRLVHSPSKQLLYSASLDSSIRIWALPS
PSHTTYAPYDETSHRGELVGHTDAVWDLALVRDESTLISCGAEGMVRVWDVSGPSGGGSL
KLRWGYNGLDGTEPESEDAEAPGATAVEAIRADLKKVAVAYTNAVVKVFEIESGRELVKL
ATDATYDGTSATQVNKIVSHPTMSFLVTAHEDKFIRIFDIITGQCTHAMPAHLDGVTSLS
IDAAGFSLVSGSHDCSVRFWDLLGSRTCTQEITTHREKAREGVLDVEFHPSLPFMASAGA
DGVVKLFSSS
Download sequence
Identical sequences jgi|Conpu1|98336|estExt_Genewise1.C_2_t40143 XP_007764864.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]