SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|98704|estExt_Genewise1.C_2_t50087 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|98704|estExt_Genewise1.C_2_t50087
Domain Number 1 Region: 9-142
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 0.0000000000523
Family Pollen allergen PHL P 1 N-terminal domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|98704|estExt_Genewise1.C_2_t50087
Sequence length 142
Sequence
MFTSLIALAALALPAFAQSYVSVSYDTTYDNSAQSMDTVACSDGVYGLASKWPTFGSVSN
FPYIGGAPAITGWDSPSCGTCWELTYSAGNIDETIYVTAIDVGEDGFNLSEEAMNALTDG
NAVAFGRVSATVTQVATSNCGN
Download sequence
Identical sequences jgi|Conpu1|98704|estExt_Genewise1.C_2_t50087 XP_007765027.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]