SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|98771|estExt_Genewise1.C_2_t50161 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|98771|estExt_Genewise1.C_2_t50161
Domain Number 1 Region: 124-339
Classification Level Classification E-value
Superfamily DNA-glycosylase 2.98e-54
Family Endonuclease III 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|98771|estExt_Genewise1.C_2_t50161
Sequence length 364
Sequence
MSAVRRSSNRLAKLTAKASPYNASVTLYEAEFITEASPTKPRPIVKKRSESTSAAAFGDE
PADIEDVKPVRAEPGPSNPVKRTVKTKTKVTTTTKSPKKPKVIKQSLETPHPAPPRWKET
YDTIKEMRANIIAPVDTMGCEQAQLTEQDPRNQRFSTLVSLMLSSQTKDEVTDAAVRKLR
EAVGGTLSMEAIIAVDEGVVAKAIEKVGFWRRKTQYIKQTAQRLKDDFDSEVPKTVDELC
SLPGVGPKMAFLALQVAWKLNVGIGVDVHVHRITNRLGWHKPPTREPEQTRLNLQSWLPI
ELHPDINLMLVGFGQTVCLPVKPRCEMCKLSTMDLCPSAKLPKSSPSKPRRVTSEELEQL
SDLD
Download sequence
Identical sequences jgi|Conpu1|98771|estExt_Genewise1.C_2_t50161 XP_007765064.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]