SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|100466|estExt_Genewise1.C_3_t40191 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|100466|estExt_Genewise1.C_3_t40191
Domain Number 1 Region: 46-195
Classification Level Classification E-value
Superfamily YbiA-like 6.28e-49
Family YbiA-like 0.0000688
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|100466|estExt_Genewise1.C_3_t40191
Sequence length 313
Sequence
MQSSVRPTTTVNTNALHVSTPSINVVPLTAPVNPTPASMPPYKRSPRGRVLFYDKNKPYY
EFTNFSPHPVEYNGKRFPTSEHLFQSFKFIDAHPEIAEYIRTCGDRPMAAFDEAHRYQSW
VRPDWRQVNIVKMEEALRLKFTQHKRLRQLLLDTGDDELIEDSPRDYFWGVGADYSGRNE
LGKALERLRDELRHENNPKYFLQPHGKRDMHRLSLQDIPSLLSPMSAAGHVSNFIRTVSN
SASSTPQSPISAVSASSKTMCEFCQQKPKFQRHRYCSRNCAQAAKMCIHCRTKPKFDKHP
YCSKTCAADYVKT
Download sequence
Identical sequences XP_007766119.1.51617 jgi|Conpu1|100466|estExt_Genewise1.C_3_t40191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]