SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|118030|estExt_Genewise1Plus.C_2_t30472 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|118030|estExt_Genewise1Plus.C_2_t30472
Domain Number 1 Region: 47-175
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000727
Family Canonical RBD 0.014
Further Details:      
 
Domain Number 2 Region: 550-591
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000964
Family HkH motif-containing C2H2 finger 0.068
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|118030|estExt_Genewise1Plus.C_2_t30472
Domain Number - Region: 280-341
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000112
Family Canonical RBD 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|118030|estExt_Genewise1Plus.C_2_t30472
Sequence length 745
Sequence
MAYNREWDKGKDDWGGDSSSWSGGGGGDRFYSRGREDDYYGEGKRRKYNNGGYDAGYSYG
DGSYDPNWGQGQANQGDHSQDYGHDERPGKPFGGKKRLVPSEPSPHVIFLGLDPDFSEAD
LQAYLVNNACNIETVTIIRERSTGTCPFTFSSCARIDGFGFAQFASVEHARAFVDPLFPF
IQIPPPASHGASATAAFYKALETGTPHNGRRVKIDYSQSALPHDKSRTRQNMNDGTRDIG
NSPAPVLLFRGLDPLSGPQAIAQAMISSAGPGNQGSKGMKRIVLIKDKVTLASFGFAFVE
FIDAQSASGVLANTMSATIHPQGFRISDKPVAASFAHPYSFQPVTDYMLRDDTSITSSMS
LGGVENTFVKYWDETATVAVLEFKVDEPVSKDSQQATSTKEKKEKKKKDDSSNKLPQASV
LPVSDKPVTLSFGKGLSVTSKPAGPTGPTKAPALGFSAEDFEGSDADKSEEYASGKDDAK
STAAKRVGPMIASKKTVNNIQKWNQVKEELKEDIGARPAPATVPTTAPTTAPTAAPAAPL
VTKSPLPQEDLEFADIGALMCLLCSRQFKTTEQLKRHDKESDLHKKNLRDSNLREVAHQK
LAQRRTESSSKGDAEGPRYRDRAQERRVMHHQPDVPLPEPSVASASKRKRHAEGPPPPPS
PPPPPTNPGEDESNVGNKLLKMMGWTEGSGLGTEGDGRVDPIQTAMYAQGVGLGASKGKD
VGKYADGYAGYVHMAQDAARERYGN
Download sequence
Identical sequences XP_007764817.1.51617 jgi|Conpu1|118030|estExt_Genewise1Plus.C_2_t30472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]