SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|124959|estExt_Genewise1Plus.C_7_t10164 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|124959|estExt_Genewise1Plus.C_7_t10164
Domain Number - Region: 26-153
Classification Level Classification E-value
Superfamily Osmotin, thaumatin-like protein 0.000244
Family Osmotin, thaumatin-like protein 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|124959|estExt_Genewise1Plus.C_7_t10164
Sequence length 153
Sequence
MLSFAVAVLALASAVIAAPTDETHAIILNNNCGTGTALWNQASSDSPQSSTTAHAAVTGG
EAWLNDGNCGIHGENCAAVEFTLDNGSVTIADISLAGSHANYTHPISFKFSQPCTQTLSC
SSADCKDAIHDPTANGPYATCDQANAGIEITFC
Download sequence
Identical sequences XP_007769234.1.51617 jgi|Conpu1|124959|estExt_Genewise1Plus.C_7_t10164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]