SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|160961|estExt_Genemark1.C_1_t10223 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|160961|estExt_Genemark1.C_1_t10223
Domain Number 1 Region: 21-218
Classification Level Classification E-value
Superfamily Osmotin, thaumatin-like protein 1.05e-16
Family Osmotin, thaumatin-like protein 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|160961|estExt_Genemark1.C_1_t10223
Sequence length 225
Sequence
MAKYAAFAVAAAAAVANAQSLNVVNKCSDSVTLFTQTSFGTIDNNVNVAAGATTDMNISN
NWDGAINVGTSSTGGPTWDGTTPFSRAEFNFYAVPGSVTYDISLIYGYNVGMEISSSDSG
CSAFACTLPSGCPVPGPDGSCYSPCCSSVSACSGGALPAGGGGCTSNAGPGPNSPFYYNS
CYNAYAFPDNDGAAGYTPADNVDFTCGNTDITLTLCPGTTSNIPK
Download sequence
Identical sequences XP_007763046.1.51617 XP_007763051.1.51617 jgi|Conpu1|160961|estExt_Genemark1.C_1_t10223 jgi|Conpu1|160968|estExt_Genemark1.C_1_t10231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]