SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|168505|estExt_Genemark1.C_130144 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|168505|estExt_Genemark1.C_130144
Domain Number 1 Region: 8-63,93-187
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 0.0000000507
Family Pollen allergen PHL P 1 N-terminal domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|168505|estExt_Genemark1.C_130144
Sequence length 187
Sequence
MFFAALPFLLASALLAKGDSGVTTFNDYDSQGGVACSGFGSSNDQGNGIYAAALGDLSPL
WTGPKCAGSIDGSKCNGSGGCNDCTGPSCAGEGQCGLCFSISCASSLDGETSGSCSGQSI
VVKVIDACPSEHPENYCKTSQFGGNINPKECCEAPGVNAFDIATSARSALSSYQGNLNIN
IESISCP
Download sequence
Identical sequences XP_007773069.1.51617 jgi|Conpu1|168505|estExt_Genemark1.C_130144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]