SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|169357|estExt_Genemark1.C_160139 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|169357|estExt_Genemark1.C_160139
Domain Number 1 Region: 1548-1831
Classification Level Classification E-value
Superfamily BEACH domain 5.36e-110
Family BEACH domain 0.000000127
Further Details:      
 
Domain Number 2 Region: 1394-1503
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000221
Family PreBEACH PH-like domain 0.016
Further Details:      
 
Domain Number 3 Region: 1918-1964,2009-2046,2090-2182,2220-2260
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000223
Family WD40-repeat 0.018
Further Details:      
 
Domain Number 4 Region: 416-588
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000176
Family Clostridium neurotoxins, the second last domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|169357|estExt_Genemark1.C_160139
Sequence length 2261
Sequence
MLRSLLTASTSTAQPGSPNPNNSPSLSRANSNSSAYAESNLSRPASAQASRDVQTMQEVM
HADVDELKFSMEVDQRIEILTRIRDTLRVQAKTADSFRAFDGFLTLVHVLSTLPAIASVS
ISKSDPGSDSGAAVRACMRAAFEVAGEALWENGANRQFFEQSVGYASLGAALDPLVADAH
TCADVLGLLLTVACRDFALVDFFIALPPSLSIDDLEAHFDRYAPRLSSARIVLPGFLGVL
WSFLRPRMESTNEDAGSLRYLTYRMLDSVTAASHANACAVTRFEPDMPSYFLAAFRRKLH
ESRADSAVALSSPVDVSEDKPKDKDKDRDMERRALQRLVRRTFELGATTEDARALLESIV
RADSESTNPSLDGDMLDAARAVSRARWPAHVLLGRGAAICTREGEIGQGQGRARGLPATG
FSVMLWANIDALPPSTPPGRTSKLFRVRTASGPVFELSVDAGGGLGLRSSTHPAHKALNS
NANGRAVVGRGRWTHVAVVHYPSRASCPSVRVFIDGVLADSVQWAYPKGAVRAEGVVYEL
GDASSSPSGGGGGGGGMSWSIASAYLFSHPLPDDIIRFAHHLGPRYTGTFQDGALARFLT
YDASTALGMHLLGGPSASSPSSSSISASVSASSTIAGAAAGSGGGGGMSGSVALGDSSAA
LRQVLKDGVPFGEDSIVWRFVPADLETSPSLSDSGELDRDGGRRHPEDQGTSTSRMRLRA
QFESSGSGEVVVMRCEAMDAAVWKLGGAGVLVRLVVLAQTAHELSRAVGVLVDCVRNCWK
NSEDMERLNGYDVLAATLRSKADLINMTTFEMLFEFMGLNFRSPDQSTIINAAAYRAIAL
DFSLWSRARPEIARVHLEHLTFLLRASRFRRFNARVRLVRLGALWKLLFALQAGWYGGSG
EEGAGEAADEGNGNQSGGERMNMMPYVVGALAALVQAPVGPEDTVKPVVSYLAATLDPRS
EMRSTGSPAVLEDLVSTLRIPAYYARFAEALPLPRVCLLLLGEHPMPVVAMQVLNMVGLG
YANSSSFHRRFELASGWTILRSVLPGCWEEGVQAAAFDLLLGVTGGGAEAHSDGQGHRHR
GGHGVKGAARQEEKVVACPQIAGVMLAVLHRGLFEMRSVGQGCDAGPSQENTASLIDALT
ALFGESTSFRQLFRMQSITQILVDCLRIHVEPGAEFSQRVDEATWSKFTGFCALVGAEKA
VHGSQRNEIQALLGDDSPQKRYALQNQVHAGMYTTLSLVREGAVSQAFSRLAEWRALVVL
TERKRNRKTVLDMREHQKQVVMYTEQIMSSVTDRSLWKDLRTERVWRLDETEGPFRIRKK
VEPFHPPSNGNSTAGNSLDGIPPTESAPSVQVERREASAAAEEEGEGNLAEEVHEDKLRK
VRHELEPGDIIEAVSTVARISGVDAFPGLLIIGQTHLYVLDGLVEQDDGEVIDAADAPKS
LFFVAGSKLEARVPQKAQRWILHKLTAFAERTFLFRDVGLELFFQDHRSLLVVFPTKLKR
LDVNNRLTTVMSRLGTTQHIGLGSALDRTALLGLVAGKSRAEMNMRAKELAHAQRQWQNR
EISNFAYLSILNQLSGRTPSDATQYPVFPWVLKDYTSESLDLSSPESYRDLTKPMGALTE
DRRAAAEARYTSLESVGEPPFHYGTHFSSSMTVCHFLIRMAPYTEMFKTLQGGEWDLPDR
LFGDLGKAWTSASRDVRGDVRELIPEFFTCPEFLENSSNHDFGVLQSTGERINDVKLPPW
AKGDATLFIALHRQALESHHVSEHLHEWIDLIWGHKQRDVASYNVFHPLSYEGSIDIDAI
TDELEREATVGIIHNFGQTPRKLFTTPHPSRNLQGLLTLPFGVERGVPEDAIRYQCKGEC
ADSIGSLVESLTFDSRNGKVVPLPQGVVCIPGRPDERVEWDEGDNDRAGALRVRVAGKVV
QTLEQIYPTCAAFADAETLLVGTSEHLVRSYALSPPLHTSGDPRGSVVTGQDGASGSGSS
ILGGGPGSPLFAHHHHASARIGLSIRETHMLRAHEAPVTCVTASGAWGVGVSGGREGAAV
VWRLGAGGASRVAGIIGGGRGVVGESTGSGGSGSGGGEAYVATIWHSESGSDEGVVGNGN
SVTCVAINESNGFIASCSRRYLCLHTINARPIARLSLSPSPSMASPMASYGEITALAFHV
REYSRVGILALGGRGCVRLVTWERGGCVSTADEYECVTRPDSWEFVEVATFKESSEGDAP
WMKKLRTLPGSKERPARVTALSFRGETLVVGDERGTCVEWA
Download sequence
Identical sequences XP_007774246.1.51617 jgi|Conpu1|169357|estExt_Genemark1.C_160139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]