SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|82142|fgenesh1_kg.6_#_132_#_isotig03383 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|82142|fgenesh1_kg.6_#_132_#_isotig03383
Domain Number 1 Region: 104-155
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.00000000000209
Family AN1-like Zinc finger 0.0023
Further Details:      
 
Domain Number 2 Region: 6-63
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.0000000023
Family AN1-like Zinc finger 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|82142|fgenesh1_kg.6_#_132_#_isotig03383
Sequence length 265
Sequence
MSSSTNTTDHDHQLLGVGQQCSAPSCHLIDFLPFKCQHCNENFCGDHFSVSGHKCPKYDE
SKHNRVAPSCPLCNEPVAIPPGQDPNVRMDRHINTECSVITGKAAKKSTPVCTRGKCGKV
LFAPISCDKCRKQFCASHRFPSDHDCVSLSTASTATKLRSKPAMSTPSLPTFKSSYRPTT
FAARPSASTGSSNQASISLPSISIANPFNPADRRAKAERESRRKAMMERAKKGLLSEEEK
LMLAGEEAERAQAVEEKKDKECVIM
Download sequence
Identical sequences jgi|Conpu1|82142|fgenesh1_kg.6_#_132_#_isotig03383 XP_007768501.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]